Sylf domain

Author: ktyz

August undefined, 2024

WebMay 1, 2011 · Here, we describe a novel phosphoinositide-binding domain in a group of proteins with a C-terminal SH3 domain named the SYLF (SH3YL1, Ysc84p/Lsb4p, Lsb3p, … WebWe're interested in your feedback! If you have a moment, please share your thoughts in this survey. Dismiss

Silphium - Wikipedia

WebJul 14, 2024 · We detail BefA's atomic structure, containing a lipid-binding SYLF domain, and demonstrate that it permeabilizes synthetic liposomes and bacterial membranes. A BefA … WebTissue proteome. GENERAL INFORMATIONi. General description of the gene and the encoded protein (s) using information from HGNC and Ensembl, as well as predictions … pa health care plans for individuals

BefA, a microbiota-secreted membrane disrupter, disseminates to …

WebSH3YL1, SH3 and SYLF domain containing 1. Synonyms RAY Links HGNC:29546. NCBI Gene ID: 26751. neXtProt AC: NX_Q96HL8. UniProt ... PR:000030844 SH3 domain-containing … WebDec 30, 2024 · The SYLF domain is an evolutionary conserved protein domain with phosphatidylinositol binding ability, whose three-dimensional structure is unknown. Here, … WebSymbol Description Category UniProt ID GIFtS GC id Score; 1: TENT5A: Terminal Nucleotidyltransferase 5A: Protein Coding: Q96IP4: 43: GC06M081498: 24.11: 2 ... pa healthchoices

CDD Conserved Protein Domain Family: SYLF - National Center for ...

Sylf domain

The N-terminal region of SH3YL1 with high affinity for.

WebNov 11, 2024 · Residual association of CFS1 AIM with autophagic compartments could be attributed to the FYVE and SYLF domain interactions with PI3P since mutating all three … Web©2009-2014 WWW.ELABINFO.COM ALL RIGHTS RESERVED. E-mail: support elabinfo.com elabinfo.com

Did you know?

WebThe SYLF domain is an evolutionary conserved domain, whose name derives from its representative protein members SH3YL1, Ysc84p/Lsb4p, Lsb3p and plant FYVE. It is also … WebAn amphipathic α helix at the N terminus of the SYLF domain is necessary for lipid binding. (A) Multiple sequence alignment of N-terminal regions of the SYLF domain from various …

WebSH3 and SYLF domain containing 1 is a protein that in humans is encoded by the SH3YL1 gene. References. WebThe present invention belongs to the bioengineering field, and relates to a method for fermentation production of L-theanine by using an Escherichia coli genetically engineered bacterium. The engineered bacterium is obtained by serving a strain as an original strain, wherein the strain is obtained after performing a single copy of T7RNAP, a dual copy of …

Webkaryotic and eukaryotic SYLF-containing protein lengths found the average prokaryotic ones to be just single SYLF domains, whereas the eukaryotic ones were longer multi-domain se … WebAug 1, 2014 · SH3YL1 regulates dorsal ruffle formation by a novel phosphoinositide-binding domain. 30: 24508479: 2014: Dock4 forms a complex with SH3YL1 and regulates cancer …

WebNov 1, 2024 · The Conserved Domain Databank (Marchler-Bauer et al., 2024) defines the SYLF domain in BefA starting at residue 114, midway through H4 (Figure S1 A), but our …

WebOct 13, 2024 · To test if BefA’s SYLF domain is sufficient to mediate its pro-proliferative effect on β cells, we cloned and expressed two truncated variants, one containing the … pa health care proxy formWebScore. SH3YL1. SH3 domain-containing YSC84-like protein 1; SH3 and SYLF domain containing 1 (342 aa) Predicted Functional Partners: SH3D19. SH3 domain-containing … pa health choices 2021WebSH3YL1 regulates dorsal ruffle formation by a novel phosphoinositide-binding domain. Hidekazu Hiroaki. 2011, The Journal of Cell Biology. Membrane ruffles are short-lived, … pa health centreWebgenome browser: aa seq: 228 aa aa seq db search msprlfnllalgfltllpsmaaqaadpprtqaveavrvlrdmvedapdkslptdmlknah … pa health care proxy formsWebWeb technologies mr.ru is using on their website. Google Analytics. Google Analytics Usage Statistics · Download List of All Websites using Google Analytics. Google Analytics offers a host of compelling features and benefits for everyone from senior executives and advertising and marketing professionals to site owners and content developers. pa healthchoices contractWebPhone: +1 877 302 8632 Fax: +1 888 205 9894 (Toll-free) E-Mail: [email protected] pa healthchoices frrWebMar 13, 2024 · Hasegawa et al. (2011) found that the SYLF domain of human SH3YL1 (617314) bound to liposomes, acidic phospholipids, and phosphatidylinositol 3,4,5 … pa health choices enrollment services